Loading...

Recombinant Mouse/Rat Insulin | Genprice

Recombinant Mouse/Rat Insulin

CAT:

15-INSLM21-N-20

Size:

20 µg

This product is intended to Research Use Only. Not for Diagnostic or In Vivo Applications

Price:

Ask

For price, please contact [email protected]

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Recombinant Mouse/Rat Insulin - image 1

Related Products

Cat	Name
INSLM21-N-20	Recombinant Mouse/Rat Insulin
INSL22-S	Rabbit Anti-Human (mouse/rat) Insulin antiserum
INSL11-M	Monoclonal Anti-Rat/Mouse Insulin/proinsulin IgG, aff pure
INSB25-P	Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]
INSA21-A	Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure
0030-50-1	Rat Insulin ELISA Kit, Quantitative, 96 tests
INSB22-M	Monoclonal Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure
IRAP11-S	Anti-Rat IRAP (Insulin regulated aminopeptidase) Antiserum #1
3760-RIM	Rat Anti-Insulin IgM ELISA Kit, 96 tests, Quantitative
3750-RIG	Rat Anti-Insulin IgG ELISA Kit, 96 tests, Quantitative

Alternative Products

Cat	Name
MBS408049-01	Insulin II (Rat, Mouse)
MBS408049-02	Insulin II (Rat, Mouse)
MDP0851	Insulin I (Rat, Mouse)
4501-v	Insulin I (Rat, Mouse)
4502-v	Insulin II (Rat, Mouse)
035-94	Insulin 1 (Rat, Mouse)
MDP0852	Insulin II (Rat, Mouse)
IS30D-100	Insulin ELISA (Mouse/Rat)
MBS408048-01	Insulin I (Rat, Mouse)
MBS408048-02	Insulin I (Rat, Mouse)